ID1 monoclonal antibody (M13), clone 3F8

Product Sizes

100 ug

£333.00

H00003397-M13-100UG

About this Product

SKU:: H00003397-M13
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3F8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant ID1.
Host:: Mouse
Immunogen:: ID1 (NP_002156, 47 a.a. ~ 155 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket