HOXB9 monoclonal antibody (M29), clone 2E8

Product Sizes

100 ug

£333.00

H00003219-M29-100UG

About this Product

SKU:: H00003219-M29
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 2E8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant HOXB9.
Host:: Mouse
Immunogen:: HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket