HOXB1 monoclonal antibody (M06), clone 2F12

Product Sizes

100 ug

£333.00

H00003211-M06-100UG

About this Product

SKU:: H00003211-M06
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 2F12
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant HOXB1.
Host:: Mouse
Immunogen:: HOXB1 (NP_002135.2, 101 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket