HMX2 monoclonal antibody (M07A), clone 1B10

Product Sizes

200 ul

£333.00

H00003167-M07A-200UL

About this Product

SKU:: H00003167-M07A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1B10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant HMX2.
Host:: Mouse
Immunogen:: HMX2 (NP_005510, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a
Reactivities:: Human
Sequence:: PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket