HIF1A monoclonal antibody (M04), clone 2E23

Product Sizes

100 ug

£333.00

H00003091-M04-100UG

About this Product

SKU:: H00003091-M04
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2E23
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant HIF1A.
Host:: Mouse
Immunogen:: HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket