HIC1 monoclonal antibody (M04), clone 2C1

Product Sizes

50 ug

£333.00

H00003090-M04-50UG

About this Product

SKU:: H00003090-M04
Application:: ELISA
translate.label.attr.clone:: 2C1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant HIC1.
Host:: Mouse
Immunogen:: HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket