HIC1 monoclonal antibody (M02), clone 2F9

Product Sizes

100 ug

£333.00

H00003090-M02-100UG

About this Product

SKU:: H00003090-M02
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2F9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant HIC1.
Host:: Mouse
Immunogen:: HIC1 (NP_006488, 396 a.a. ~ 453 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human, Rat
Sequence:: YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket