HBZ monoclonal antibody (M01), clone 3C4-1D5

Product Sizes

100 ug

£333.00

H00003050-M01-100UG

About this Product

SKU:: H00003050-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3C4-1D5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant HBZ.
Host:: Mouse
Immunogen:: HBZ (AAH27892, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket