H3F3B monoclonal antibody (M01), clone 2D7-H1

Product Sizes

100 ug

£333.00

H00003021-M01-100UG

About this Product

SKU:: H00003021-M01
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2D7-H1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant H3F3B.
Host:: Mouse
Immunogen:: H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket