GFRA1 monoclonal antibody (M01), clone 1G4

Product Sizes

100 ug

£333.00

H00002674-M01-100UG

About this Product

SKU:: H00002674-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1G4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant GFRA1.
Host:: Mouse
Immunogen:: GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket