GDF8 monoclonal antibody (M07), clone 3E7

Product Sizes

100 ug

£333.00

H00002660-M07-100UG

About this Product

SKU:: H00002660-M07
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3E7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant GDF8.
Host:: Mouse
Immunogen:: GDF8 (NP_005250, 241 a.a. ~ 310 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket