GCN5L2 monoclonal antibody (M06), clone 3F8

Product Sizes

100 ug

£333.00

H00002648-M06-100UG

About this Product

SKU:: H00002648-M06
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3F8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
Host:: Mouse
Immunogen:: GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human, Rat
Sequence:: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket