GBX2 monoclonal antibody (M08), clone 3B6

Product Sizes

100 ug

£333.00

H00002637-M08-100UG

About this Product

SKU:: H00002637-M08
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant GBX2.
Host:: Mouse
Immunogen:: GBX2 (NP_001476, 141 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket