FUCA2 monoclonal antibody (M03), clone 1D2

Product Sizes

100 ug

£333.00

H00002519-M03-100UG

About this Product

SKU:: H00002519-M03
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1D2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant FUCA2.
Host:: Mouse
Immunogen:: FUCA2 (NP_114409.2, 368 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: YETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket