FRZB monoclonal antibody (M07), clone 3C3
Product Sizes
100 ug
£333.00
H00002487-M07-100UG
About this Product
- SKU:
- H00002487-M07
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 3C3
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a full length recombinant FRZB.
- Host:
- Mouse
- Immunogen:
- FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Reactivities:
- Human
- Sequence:
- HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00002487-M07
