FOXF2 monoclonal antibody (M15), clone 4F8

Product Sizes

100 ug

£333.00

H00002295-M15-100UG

About this Product

SKU:: H00002295-M15
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4F8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant FOXF2.
Host:: Mouse
Immunogen:: FOXF2 (NP_001443, 207 a.a. ~ 340 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: YHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHIECHSPYTSPAAHW
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket