FKBP4 monoclonal antibody (M01), clone 5C11

Product Sizes

100 ug

£333.00

H00002288-M01-100UG

About this Product

SKU:: H00002288-M01
Application:: ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 5C11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant FKBP4.
Host:: Mouse
Immunogen:: FKBP4 (AAH07924, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket