ESR2 monoclonal antibody (M01), clone 3F3

Product Sizes

100 ug

£333.00

H00002100-M01-100UG

About this Product

SKU:: H00002100-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3F3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ESR2.
Host:: Mouse
Immunogen:: ESR2 (NP_001428, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket