ERBB2 monoclonal antibody (M02), clone 2D4

Product Sizes

100 ug

£333.00

H00002064-M02-100UG

About this Product

SKU:: H00002064-M02
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2D4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ERBB2.
Host:: Mouse
Immunogen:: ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket