EPHB2 monoclonal antibody (M02), clone 3B3

Product Sizes

100 ug

£333.00

H00002048-M02-100UG

About this Product

SKU:: H00002048-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant EPHB2.
Host:: Mouse
Immunogen:: EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket