ELA2 monoclonal antibody (M06J), clone 3B1

Product Sizes

100 ug

£494.00

H00001991-M06J-100UG

About this Product

SKU:: H00001991-M06J
Additional Names:: CXGrade
Application:: ELISA
translate.label.attr.clone:: 3B1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ELA2. This product is belong to Cell Culture Grade Antibody (CX Grade).
Host:: Mouse
Immunogen:: ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket