EGF monoclonal antibody (M01C), clone 2F1
Product Sizes
200 ul
£333.00
H00001950-M01C-200UL
About this Product
- SKU:
- H00001950-M01C
- Additional Names:
- CXGrade
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 2F1
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant EGF. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- EGF (NP_001954, 926 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2b, kappa
- Reactivities:
- Human
- Sequence:
- NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00001950-M01C
