EDN2 monoclonal antibody (M01), clone 3B4-1C5

Product Sizes

100 ug

£333.00

H00001907-M01-100UG

About this Product

SKU:: H00001907-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B4-1C5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant EDN2.
Host:: Mouse
Immunogen:: EDN2 (AAH34393, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket