DLX1 monoclonal antibody (M07), clone 1D11

Product Sizes

100 ug

£333.00

H00001745-M07-100UG

About this Product

SKU:: H00001745-M07
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 1D11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DLX1.
Host:: Mouse
Immunogen:: DLX1 (NP_835221, 152 a.a. ~ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: YLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket