DAF monoclonal antibody (M01), clone 1G3

Product Sizes

100 ug

£333.00

H00001604-M01-100UG

About this Product

SKU:: H00001604-M01
Application:: ELISA, Proximity Ligation Assay, Western Blot
translate.label.attr.clone:: 1G3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DAF.
Host:: Mouse
Immunogen:: DAF (NP_000565, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket