CUX1 monoclonal antibody (M01J), clone 2A10
Product Sizes
100 ug
£494.00
H00001523-M01J-100UG
About this Product
- SKU:
- H00001523-M01J
- Additional Names:
- CXGrade
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Immunoprecipitation, Western Blot
- translate.label.attr.clone:
- 2A10
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant CUX1. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- CUX1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG1, kappa
- Reactivities:
- Human
- Sequence:
- AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00001523-M01J
