CPS1 monoclonal antibody (M02), clone 4A10
Product Sizes
100 ug
£333.00
H00001373-M02-100UG
About this Product
- SKU:
- H00001373-M02
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 4A10
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant CPS1.
- Host:
- Mouse
- Immunogen:
- CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG1, lambda
- Reactivities:
- Human
- Sequence:
- ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00001373-M02
