COX5B monoclonal antibody (M03), clone 1E8

Product Sizes

100 ug

£333.00

H00001329-M03-100UG

About this Product

SKU:: H00001329-M03
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1E8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant COX5B.
Host:: Mouse
Immunogen:: COX5B (NP_001853, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: VPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket