CDX4 monoclonal antibody (M15), clone 3F11

Product Sizes

100 ug

£333.00

H00001046-M15-100UG

About this Product

SKU:: H00001046-M15
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3F11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant CDX4.
Host:: Mouse
Immunogen:: CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket