CDK4 monoclonal antibody (M08A), clone 3E7

Product Sizes

200 ul

£333.00

H00001019-M08A-200UL

About this Product

SKU:: H00001019-M08A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3E7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CDK4.
Host:: Mouse
Immunogen:: CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket