CDH17 monoclonal antibody (M03), clone 3H2

Product Sizes

100 ug

£333.00

H00001015-M03-100UG

About this Product

SKU:: H00001015-M03
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3H2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CDH17.
Host:: Mouse
Immunogen:: CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket