CD19 monoclonal antibody (M02), clone 1C9

Product Sizes

100 ug

£333.00

H00000930-M02-100UG

About this Product

SKU:: H00000930-M02
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1C9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CD19.
Host:: Mouse
Immunogen:: CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket