CD3E monoclonal antibody (M04), clone 4C1

Product Sizes

100 ug

£333.00

H00000916-M04-100UG

About this Product

SKU:: H00000916-M04
Application:: ELISA, Proximity Ligation Assay, Western Blot
translate.label.attr.clone:: 4C1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant CD3E.
Host:: Mouse
Immunogen:: CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket