RUNX2 monoclonal antibody (M16A), clone 4E5

Product Sizes

200 ul

£333.00

H00000860-M16A-200UL

About this Product

SKU:: H00000860-M16A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4E5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant RUNX2.
Host:: Mouse
Immunogen:: RUNX2 (NP_001019801.1, 311 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgM, kappa
Reactivities:: Human, Mouse
Sequence:: TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket