CACNA1C monoclonal antibody (M20), clone 4D10

Product Sizes

100 ug

£333.00

H00000775-M20-100UG

About this Product

SKU:: H00000775-M20
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4D10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CACNA1C.
Host:: Mouse
Immunogen:: CACNA1C (NP_000710, 2039 a.a. ~ 2138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket