CA7 monoclonal antibody (M06), clone 3B7

Product Sizes

100 ug

£333.00

H00000766-M06-100UG

About this Product

SKU:: H00000766-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CA7.
Host:: Mouse
Immunogen:: CA7 (NP_005173, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: NIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVH*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket