CAPN5 monoclonal antibody (M02A), clone 3C10

Product Sizes

200 ul

£333.00

H00000726-M02A-200UL

About this Product

SKU:: H00000726-M02A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3C10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CAPN5.
Host:: Mouse
Immunogen:: CAPN5 (NP_004046, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: VLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNLQALHTLHLRDRNSRQPSN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket