PRDM1 monoclonal antibody (M10), clone 1G9

Product Sizes

100 ug

£333.00

H00000639-M10-100UG

About this Product

SKU:: H00000639-M10
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1G9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant PRDM1.
Host:: Mouse
Immunogen:: PRDM1 (NP_001189, 422 a.a. ~ 493 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket