ASCL1 monoclonal antibody (M01), clone 7E11

Product Sizes

100 ug

£333.00

H00000429-M01-100UG

About this Product

SKU:: H00000429-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 7E11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ASCL1.
Host:: Mouse
Immunogen:: ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket