ASAH1 monoclonal antibody (M02), clone 1A7

Product Sizes

100 ug

£333.00

H00000427-M02-100UG

About this Product

SKU:: H00000427-M02
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 1A7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ASAH1.
Host:: Mouse
Immunogen:: ASAH1 (NP_808592, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket