APOH monoclonal antibody (M04), clone 2F12

Product Sizes

50 ug

£333.00

H00000350-M04-50UG

About this Product

SKU:: H00000350-M04
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2F12
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant APOH.
Host:: Mouse
Immunogen:: APOH (NP_000033, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket