ALPPL2 monoclonal antibody (M07), clone 2B3

Product Sizes

100 ug

£333.00

H00000251-M07-100UG

About this Product

SKU:: H00000251-M07
Application:: ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 2B3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ALPPL2.
Host:: Mouse
Immunogen:: ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket