AKT1 monoclonal antibody (M26), clone 3E11

Product Sizes

100 ug

£333.00

H00000207-M26-100UG

About this Product

SKU:: H00000207-M26
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3E11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AKT1.
Host:: Mouse
Immunogen:: AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket