AEBP1 monoclonal antibody (M01), clone 1D2

Product Sizes

100 ug

£333.00

H00000165-M01-100UG

About this Product

SKU:: H00000165-M01
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 1D2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AEBP1.
Host:: Mouse
Immunogen:: AEBP1 (NP_001120, 912 a.a. ~ 1013 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket