AP2B1 monoclonal antibody (M01), clone 2D5

Product Sizes

50 ug

£333.00

H00000163-M01-50UG

About this Product

SKU:: H00000163-M01
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 2D5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AP2B1.
Host:: Mouse
Immunogen:: AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket