ADORA2A monoclonal antibody (M17), clone 4E4

Product Sizes

100 ug

£333.00

H00000135-M17-100UG

About this Product

SKU:: H00000135-M17
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 4E4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ADORA2A.
Host:: Mouse
Immunogen:: ADORA2A (NP_000666.2, 147 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket