ABO monoclonal antibody (M08), clone 1B7

Product Sizes

100 ug

£333.00

H00000028-M08-100UG

About this Product

SKU:: H00000028-M08
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ABO.
Host:: Mouse
Immunogen:: ABO (NP_065202.2, 273 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket