Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Interleukin 22, Recombinant, Rat (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF)

Product Sizes
10ug
£806.00
I8443-17-10UG
About this Product
SKU:
I8443-17
Extra Details:
Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. It belongs to the IL-10-related cytokine family that consists of six members (IL-10, IL-19, IL-20, IL-22, IL-24/MDA-7 and IL-26/AK155). These proteins share structural homology and some degree of amino acid sequence homology to IL-10. Receptors for these proteins are members of the class II cytokine receptor family. The rat IL-22 coding region corresponding to amino acids 48-179 was deduced from a rat genomic clone (Genbank accession #AC111483). The N-terminal portion was cloned from rat adipocyte first strands using degenerate forward primers based on the human and mouse IL-22 amino acid sequences in two independent PCR reactions. Rat IL-22 cDNA predicts a 179aa residue precursor protein with a putative 33aa signal peptide that is cleaved to generate a 147aa mature protein, which shares ~92% and 79% aa sequence identity with mouse and human IL-22, respectively. IL-22 signals through a heterodimeric receptor complex composed of the IL-22R (CRF2-9) subunit and the b chain of IL-10R. In addition, IL-22 also binds to a secreted member of the class II cytokine receptor family called IL-22BP that acts as a natural IL-22 antagonist. IL-22 upregulates acute-phase reactants in the liver and hepatoma cells. In a rat hepatoma cell line, IL-22 has been shown to activate the Jak/STAT and MAPK signaling pathways. Recombiant protein corresponding to Leu27-Val172, with an N-terminal Met from rat Interleukin 22, expressed in E. coli. Amino Acid Sequence: MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLR NACV Molecular Mass: The methionyl form of recombinant rat IL-22 has a predicted molecular mass of ~16.7kD. Activity: Measured by its ability to induce IL-10 secretion in Colo205 cells. The ED50 is typically 150-750pg/ml. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile PBS, 0.1% HSA or BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight:
16.7
Physical State:
Supplied as a lyophilized powder from PBS, BSA. Reconstitute with 1ml sterile PBS, 0.1% HSA or BSA.
Purity:
≥97% as determined by SDS-PAGE and visualized by silver stain. Endotoxin: ≤0.1EU/ug (LAL)
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins