CCR4-Not Transcription Complex, Subunit 2 (CNOT2, CDC36, HSPC131, Negative Regulator of Transcription Subunit 2 Homolog, NOT2H)
Product Sizes
100ug
£659.00
C2099-68W-100UG
About this Product
- SKU:
- C2099-68W
- Application:
- Western Blot
- translate.label.attr.clone:
- 2191C2a
- Clonality:
- Monoclonal
- Extra Details:
- The CCR4-Not complex is a highly conserved regulator of mRNA metabolism. Applications: Suitable for use in Western Blot and Dot Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to human CCR4-Not Transcription Complex, Subunit 2 corresponding to amino acids within the internal portion of the protein. Immunogen sequence: FPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLP
- Isotype:
- IgG2a
- Physical State:
- Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
- Purity:
- Purified by Protein G affinity chromatography from hybridoma culture supernatant
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human CCR4-Not Transcription Complex, Subunit 2.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Monoclonal Antibody
