Fibroblast Growth Factor 2, Active, Recombinant, Mouse, aa1-154 (Fgf2)
Product Sizes
10ug
£381.00
586889-10UG
About this Product
- SKU:
- 586889
- Extra Details:
- Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. Full length recombinant protein corresponding to aa1-154 from mouse Fibroblast growth factor 2, expressed in E.coli. Molecular Weight: ~17.15kD Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8ng/ml. Amino Acid Sequence: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molecular Weight:
- 17.15
- Physical State:
- Supplied as a lyophilized powder from 20mM PBS, pH 7.0, 0.02% Tween 80, 4% Sucrose, 4% Manntiol. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.
- Purity:
- ≥95% (SDS-PAGE) Endotoxin: ≤0.01EU/ug (LAL)
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins
